Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium phytofermentans UPF0059 membrane protein Cphy_1637 (Cphy_1637)

This Recombinant Clostridium phytofermentans UPF0059 membrane protein Cphy_1637 (Cphy_1637) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

UPF0059 membrane protein Cphy_1637

UniProt

A9KRD5

Expression Region

1-190

Origin

Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFTLFTLAIGLAMDTFAVSVCKGLAMKKMSLKKAFINGAYFGLFQAGMPIIGYFLGIS FRNYITKIDHWISFVLLVFLGIKMLKEAFDNEACSTNDSVAFRVMIVLAVATSIDALAVG ITFAFLKVNLLLAVSLIGIITFLLSMLGVRLGHVFGARYKRVAECVGGIVLIVLGFKILL EHLGILAQLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-100 1x 100 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details