Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0059 membrane protein PC1_1922 (PC1_1922)

This Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0059 membrane protein PC1_1922 (PC1_1922) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

UPF0059 membrane protein PC1_1922

UniProt

C6DG20

Expression Region

1-190

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMSATLILAFGMSMDAFAASIGKGAVLHNPRFRDAIRTGLIFGVIEAITPLIGWALGFF ASQYILEWDHWVAFTLLLILGGRMVVEGFKGSSDCRCEKVKNHSLALLVCTAIATSLDAM AIGVGLAFLQVNILHTAMVIGCATMIMVTLGMMIGRYIGPILGKKAEVMGGLVLIGIGCN ILYEHLGYAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-500 1x 500 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-500 1x 500 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-intact (HCGab/52), CF647 conjugate, 0.1mg/mL
BNC470052-100 1x 100 µL

HCG-intact (HCGab/52), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details