Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella sp. Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A1RJZ2

Expression Region

1-192

Origin

Shewanella sp. (strain W3-18-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLSYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-human CD40
E16FHF040-100 100 Tests

FITC anti-human CD40

Sign In for Pricing
View Details
ZNF700 Lentiviral Activation Particles (h)
sc-413854-LAC 200 µL

ZNF700 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
KCNN2 siRNA (Rat)
orb1832452-01 15 nmol

KCNN2 siRNA (Rat)

Sign In for Pricing
View Details
KCNN2 siRNA (Rat)
orb1832452-02 30 nmol

KCNN2 siRNA (Rat)

Sign In for Pricing
View Details
Thyroxine Binding Globulin, CT (SERPINA7, T4-binding Globulin, Serpin A7, TBG) (AP) discontinued
T5461-01G-AP 200 µL

Thyroxine Binding Globulin, CT (SERPINA7, T4-binding Globulin, Serpin A7, TBG) (AP) discontinued

Sign In for Pricing
View Details
R-(-)-p-Synephrine Hydrochloride
TRC-S920015-50MG 50 mg

R-(-)-p-Synephrine Hydrochloride

Sign In for Pricing
View Details