Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella putrefaciens Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella putrefaciens Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A4Y6J0

Expression Region

1-192

Origin

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLSYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAAVGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnmt3b Antibody
KC-41941-01 50 μL

Dnmt3b Antibody

Sign In for Pricing
View Details
Dnmt3b Antibody
KC-41941-02 100 µL

Dnmt3b Antibody

Sign In for Pricing
View Details
Dnmt3b Antibody
KC-41941-03 1 mL

Dnmt3b Antibody

Sign In for Pricing
View Details
AGPAT5 (NM_018361) Human Recombinant Protein
TP310280 20 µg

AGPAT5 (NM_018361) Human Recombinant Protein

Sign In for Pricing
View Details
Human PKD1L1 activation kit by CRISPRa
GA116174 1 Kit

Human PKD1L1 activation kit by CRISPRa

Sign In for Pricing
View Details
Bromocyclopropane-d5
TRC-B682763-250MG 250 mg

Bromocyclopropane-d5

Sign In for Pricing
View Details