Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella putrefaciens Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella putrefaciens Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A4Y6J0

Expression Region

1-192

Origin

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLSYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAAVGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Myometrium
CS800059 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF488A conjugate, 0.1mg/mL
BNC882013-100 1x 100 µL

CD3e, Mouse (145-2C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human YIPF4 activation kit by CRISPRa
GA113469 1 Kit

Human YIPF4 activation kit by CRISPRa

Sign In for Pricing
View Details
PYK2 (PTK2B) Human Gene Knockout Kit (CRISPR)
KN203808 1 Kit

PYK2 (PTK2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HPSE2 (NM_001166244) Human Over-expression Lysate
LC433242 20 µg

HPSE2 (NM_001166244) Human Over-expression Lysate

Sign In for Pricing
View Details
HEXIM1 Antibody
KC-1028-01 50 μL

HEXIM1 Antibody

Sign In for Pricing
View Details