Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A5UBJ2

Expression Region

1-192

Origin

Haemophilus influenzae (strain PittEE)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVD HYILIPLNATFLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVAADIPATFRGSAIALITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfo-Cyanine7.5 amine, 100 mg
663C0 100 mg

Sulfo-Cyanine7.5 amine, 100 mg

Sign In for Pricing
View Details
Sodium Hydroxide 6M (6N) Solution
2424I 00500 500 mL

Sodium Hydroxide 6M (6N) Solution

Sign In for Pricing
View Details
ZNF806 antibody - C-terminal region
MBS3210192-01 0.1 mL

ZNF806 antibody - C-terminal region

Sign In for Pricing
View Details
ZNF806 antibody - C-terminal region
MBS3210192-02 5x 0.1 mL

ZNF806 antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Mouse POU domain, class 3, transcription factor 2 (Pou3f2)
MBS950913-01 0.02 mg (E-Coli)

Recombinant Mouse POU domain, class 3, transcription factor 2 (Pou3f2)

Sign In for Pricing
View Details
Recombinant Mouse POU domain, class 3, transcription factor 2 (Pou3f2)
MBS950913-02 0.02 mg (Yeast)

Recombinant Mouse POU domain, class 3, transcription factor 2 (Pou3f2)

Sign In for Pricing
View Details