Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A5UBJ2

Expression Region

1-192

Origin

Haemophilus influenzae (strain PittEE)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVD HYILIPLNATFLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVAADIPATFRGSAIALITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1311634 3'UTR Luciferase Stable Cell Line
TU217974 1.0 mL

RGD1311634 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ARL10 Rabbit Polyclonal Antibody (HRP)
orb2094560 100 µL

ARL10 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal FCER1G Antibody [FITC]
NBP3-06225F 0.1 mL

Rabbit Polyclonal FCER1G Antibody [FITC]

Sign In for Pricing
View Details
Rhox9 Protein Vector (Rat) (pPB-C-His)
PV301466 500 ng

Rhox9 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp.hydrophila Hydroxylamine reductase (hcp), partial
MBS1205007 Inquire

Recombinant Aeromonas hydrophila subsp.hydrophila Hydroxylamine reductase (hcp), partial

Sign In for Pricing
View Details
Human CCL22/C-C motif chemokine 22 ELISA Kit
EK19205 Inquire

Human CCL22/C-C motif chemokine 22 ELISA Kit

Sign In for Pricing
View Details