Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A5UFC0

Expression Region

1-192

Origin

Haemophilus influenzae (strain PittGG)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVD HYILIPLNATFLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVAADIPATFRGSAIALITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPA2 (h) -PR
sc-62507-PR 10 µM - 20 µL

IMPA2 (h) -PR

Sign In for Pricing
View Details
Recombinant Mouse BTNL9 (C-Fc)
C10D-50ug 50 µg

Recombinant Mouse BTNL9 (C-Fc)

Sign In for Pricing
View Details
PRICKLE1, CT (PRICKLE1, RILP, Prickle-like protein 1, REST/NRSF-interacting LIM domain protein 1) (MaxLight 650) discontinued
040430-ML650 100 µL

PRICKLE1, CT (PRICKLE1, RILP, Prickle-like protein 1, REST/NRSF-interacting LIM domain protein 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
RCC2 Antibody
A39608-100UG 100 µg

RCC2 Antibody

Sign In for Pricing
View Details
ZFP106 Antibody
E38PA2757 100 µL

ZFP106 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal AP3S1 Antibody [Alexa Fluor 647]
NBP1-76588AF647 0.1 mL

Rabbit Polyclonal AP3S1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details