Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella baltica Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A6WN18

Expression Region

1-192

Origin

Shewanella baltica (strain OS185)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLSYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human PD-L1 (Programmed Cell Death Protein 1 Ligand 1) ELISA Kit
E-UNEL-H0341-01 5x 96 Tests

Uncoated Human PD-L1 (Programmed Cell Death Protein 1 Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human PD-L1 (Programmed Cell Death Protein 1 Ligand 1) ELISA Kit
E-UNEL-H0341-02 15x 96 Tests

Uncoated Human PD-L1 (Programmed Cell Death Protein 1 Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Human INTS1 activation kit by CRISPRa
GA108789 1 Kit

Human INTS1 activation kit by CRISPRa

Sign In for Pricing
View Details
Zfp740 (NM_153194) Mouse Tagged ORF Clone
MG200524 10 µg

Zfp740 (NM_153194) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FTCD Goat Polyclonal Antibody
AB0160-200 600 µg

FTCD Goat Polyclonal Antibody

Sign In for Pricing
View Details
ZNF671 antibody
FNab09727 100 µg

ZNF671 antibody

Sign In for Pricing
View Details