Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella baltica Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A6WN18

Expression Region

1-192

Origin

Shewanella baltica (strain OS185)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLSYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hgd Mouse Gene Knockout Kit (CRISPR)
KN307689BN 1 Kit

Hgd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Integrin alpha 9 (ITGA9) Rabbit Polyclonal Antibody
TA377605 100 µL

Integrin alpha 9 (ITGA9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tas2r107 Mouse Gene Knockout Kit (CRISPR)
KN517194 1 Kit

Tas2r107 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RRM2 (NM_001034) Human Over-expression Lysate
LY421950 100 µg

RRM2 (NM_001034) Human Over-expression Lysate

Sign In for Pricing
View Details
CD6 (C6/372 + 3F7B5), 0.2mg/mL
BNUB1228-500 1x 500 µL

CD6 (C6/372 + 3F7B5), 0.2mg/mL

Sign In for Pricing
View Details
Bromanilic Acid
TRC-B678405-2.5G 2.5 g

Bromanilic Acid

Sign In for Pricing
View Details