Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella baltica Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A6WN18

Expression Region

1-192

Origin

Shewanella baltica (strain OS185)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLSYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NDUFAF1 Antibody
RC-15993-01 50 μL

Recombinant NDUFAF1 Antibody

Sign In for Pricing
View Details
Recombinant NDUFAF1 Antibody
RC-15993-02 100 µL

Recombinant NDUFAF1 Antibody

Sign In for Pricing
View Details
Recombinant NDUFAF1 Antibody
RC-15993-03 1 mL

Recombinant NDUFAF1 Antibody

Sign In for Pricing
View Details
Kininogen-1 Antibody
KC-1789-01 50 μL

Kininogen-1 Antibody

Sign In for Pricing
View Details
Kininogen-1 Antibody
KC-1789-02 100 µL

Kininogen-1 Antibody

Sign In for Pricing
View Details
Kininogen-1 Antibody
KC-1789-03 1 mL

Kininogen-1 Antibody

Sign In for Pricing
View Details