Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sediminis Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella sediminis Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A8FUY0

Expression Region

1-192

Origin

Shewanella sediminis (strain HAW-EB3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASVLSYLVN QYLLLPFELGYLRTMSFILVIAVVVQFTEMLVQKTSASLYRALGIYLPLITTNCAVLGVA LLNISEKHNFIESAIYGFGAAVGFSLVLILFSAMRERLAAADVPLPFRGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tripeptidyl peptidase II (TPP2) Human Gene Knockout Kit (CRISPR)
KN207917 1 Kit

Tripeptidyl peptidase II (TPP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TECTB (N-term) Rabbit Polyclonal Antibody
AP54215PU-N 400 µL

TECTB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spiramycin Adipate
TRC-S682365-250MG 250 mg

Spiramycin Adipate

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS710495 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
2,3,4-Tri-O-acetyl-D-xylopyranose
TRC-T767020-250MG 250 mg

2,3,4-Tri-O-acetyl-D-xylopyranose

Sign In for Pricing
View Details
CD69 Antibody
8C15597-AAT 50 µg

CD69 Antibody

Sign In for Pricing
View Details