Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bifidobacterium longum subsp. infantis UPF0059 membrane protein Blon_0280/BLIJ_0284 (Blon_0280, BLIJ_0284)

This Recombinant Bifidobacterium longum subsp. infantis UPF0059 membrane protein Blon_0280/BLIJ_0284 (Blon_0280, BLIJ_0284) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

UPF0059 membrane protein Blon_0280/BLIJ_0284

UniProt

B7GTW5

Expression Region

1-192

Origin

Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIAIIVQTLLISVSVAMDAFAVSIGKGLTVSRVRPGDAVRSALWFGGSQALFLILGHYAA SAFSAYVTAFDHWIIFGLLAFIGGNMVHEAYEEDAENAKETAQFDWKHMLPLAVACSIDA FAVGVSLAFMATSVPFAILCISVVTGLFSAAGLYIGRAFGAHWQKPAQIAGGVVLILIGV KVLLEHLGVIAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), Biotin conjugate, 0.1mg/mL
BNCB0158-500 1x 500 µL

Cytokeratin 17 (E3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (5.8A), CF568 conjugate, 0.1mg/mL
BNC680191-500 1x 500 µL

MyoD1 (5.8A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details