Recombinant Bifidobacterium longum subsp. infantis UPF0059 membrane protein Blon_0280/BLIJ_0284 (Blon_0280, BLIJ_0284)
This Recombinant Bifidobacterium longum subsp. infantis UPF0059 membrane protein Blon_0280/BLIJ_0284 (Blon_0280, BLIJ_0284) spans the amino acid sequence from region 1-192.
Product Specifications
Product Name Alternative
UPF0059 membrane protein Blon_0280/BLIJ_0284
UniProt
B7GTW5
Expression Region
1-192
Origin
Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MIAIIVQTLLISVSVAMDAFAVSIGKGLTVSRVRPGDAVRSALWFGGSQALFLILGHYAA SAFSAYVTAFDHWIIFGLLAFIGGNMVHEAYEEDAENAKETAQFDWKHMLPLAVACSIDA FAVGVSLAFMATSVPFAILCISVVTGLFSAAGLYIGRAFGAHWQKPAQIAGGVVLILIGV KVLLEHLGVIAF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470669-100 1x 100 µL
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0158-500 1x 500 µL
Cytokeratin 17 (E3), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 