Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio splendidus Electron transport complex protein RnfA (rnfA)

This Recombinant Vibrio splendidus Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B7VLT9

Expression Region

1-192

Origin

Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVSAYLVE TYILTPLGIEYLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINENHNFIQSIIYGFGAAVGFSLVLILFAAMRERIAVADVPMPFKGASIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Formylpentanamido PEG
125000-6.1G 1 g

Ɑ-Methoxy-ω-Formylpentanamido PEG

Sign In for Pricing
View Details
Recombinant Mouse Cadherin-3/CDH3 Protein (Fc Tag)
PKSM040969-01 10 µg

Recombinant Mouse Cadherin-3/CDH3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cadherin-3/CDH3 Protein (Fc Tag)
PKSM040969-02 50 µg

Recombinant Mouse Cadherin-3/CDH3 Protein (Fc Tag)

Sign In for Pricing
View Details
Des-O-Phosphono T-705RMP-13C5 Diacetate
TRC-D003708-2.5MG 2.5 mg

Des-O-Phosphono T-705RMP-13C5 Diacetate

Sign In for Pricing
View Details
Human BBX activation kit by CRISPRa
GA111321 1 Kit

Human BBX activation kit by CRISPRa

Sign In for Pricing
View Details