Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfA (rnfA)

This Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B8GMB4

Expression Region

1-192

Origin

Thioalkalivibrio sp. (strain HL-EbGR7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYALILISTVLVNNFVLVKFLGLCPFMGVSRKVETATGMGLATTFVLTLSSVCSYLVN EYLLAPLGLEYLRTIAFILVIAAVVQFTEMVVHKTSPLLYNVLGIFLPLITTNCAVLGVA LLNVQEAHGFIESALYGLGAAVGFSLVLVLFASIRERVAVADVPLPFKGNAIALITAGLM SLGFMGFIGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP4B Antibody
MBS7125303-01 0.05 mL

CHMP4B Antibody

Sign In for Pricing
View Details
CHMP4B Antibody
MBS7125303-02 0.1 mL

CHMP4B Antibody

Sign In for Pricing
View Details
CHMP4B Antibody
MBS7125303-03 5x 0.1 mL

CHMP4B Antibody

Sign In for Pricing
View Details
CNTF, Mouse
MBS8575406-01 0.005 mg

CNTF, Mouse

Sign In for Pricing
View Details
CNTF, Mouse
MBS8575406-02 5x 0.005 mg

CNTF, Mouse

Sign In for Pricing
View Details
Syde1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3461205 3x 1.0 µg

Syde1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details