Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfA (rnfA)

This Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B8GMB4

Expression Region

1-192

Origin

Thioalkalivibrio sp. (strain HL-EbGR7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYALILISTVLVNNFVLVKFLGLCPFMGVSRKVETATGMGLATTFVLTLSSVCSYLVN EYLLAPLGLEYLRTIAFILVIAAVVQFTEMVVHKTSPLLYNVLGIFLPLITTNCAVLGVA LLNVQEAHGFIESALYGLGAAVGFSLVLVLFASIRERVAVADVPLPFKGNAIALITAGLM SLGFMGFIGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTUS2 Lentiviral Activation Particles (m)
sc-429532-LAC 200 µL

MTUS2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Mouse Serum IgG3 detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)
80150-G3 1 Kit

Mouse Serum IgG3 detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

Sign In for Pricing
View Details
NEGR1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
31693126 3x 1.0µg DNA

NEGR1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Recombinant Human CA9 Protein (Fc Tag)
MBS2581106-01 0.02 mg

Recombinant Human CA9 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CA9 Protein (Fc Tag)
MBS2581106-02 0.1 mg

Recombinant Human CA9 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CA9 Protein (Fc Tag)
MBS2581106-03 5x 0.1 mg

Recombinant Human CA9 Protein (Fc Tag)

Sign In for Pricing
View Details