Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella sp. Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q0HVF5

Expression Region

1-192

Origin

Shewanella sp. (strain MR-7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLGYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAAVGFSLVLILFSAMRERLAAADVPMPFKGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PCDHGB7 Protein
E30P04184A 50 µg

Recombinant Human PCDHGB7 Protein

Sign In for Pricing
View Details
Mouse β adrenergic receptor kinase 1 (ADRBK1) ELISA kit
GTR10426057 96 Well

Mouse β adrenergic receptor kinase 1 (ADRBK1) ELISA kit

Sign In for Pricing
View Details
TRNAL32 Protein Vector (Human) (pPB-N-His)
PV139359 500 ng

TRNAL32 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
TMEM202 AAV Vector (Human) (CMV)
46988101 1 µg

TMEM202 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
KLC3 Rabbit pAb
E45R20890N-100 100 µL

KLC3 Rabbit pAb

Sign In for Pricing
View Details
MOPSO Buffer 0.2M, pH 6.5
41320124-1 100 mL

MOPSO Buffer 0.2M, pH 6.5

Sign In for Pricing
View Details