Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfA (rnfA)

This Recombinant Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q8D890

Expression Region

1-192

Origin

Vibrio vulnificus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYILLLIGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTMASVCAYLVE SYILEPLHIEYLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINENHSFVESIIYGFGAAVGFSLVLILFASMRERISAADVPAPFKGASIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse CD86 mAb (AF488) [GL-1]
E2781344 100 Tests

Rat Anti-Mouse CD86 mAb (AF488) [GL-1]

Sign In for Pricing
View Details
RHOV-set siRNA/shRNA/RNAi Lentivector (Human)
39531091 4x 500 ng

RHOV-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
FAM138A sgRNA CRISPR Lentivector (Human) (Target 1)
K0747302 1.0 µg DNA

FAM138A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rat IgE (Immunoglobulin E) ELISA Kit
EKF58258 96 Tests

Rat IgE (Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Csn3 shRNA (UAS) - Lentiviral mouse Csn3 shRNA (UAS, GFP) (100)
GTR15162057 1 Vial

Lentiviral mouse Csn3 shRNA (UAS) - Lentiviral mouse Csn3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rat Sprague Dawley IgG Affinity Purified 50mg
IRTSDIGGAP50MG 50 mg

Rat Sprague Dawley IgG Affinity Purified 50mg

Sign In for Pricing
View Details