Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella oneidensis Electron transport complex protein RnfA (rnfA)

This Recombinant Shewanella oneidensis Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q8EE81

Expression Region

1-192

Origin

Shewanella oneidensis (strain MR-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLGYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAAVGFSLVLILFSAMRERLAAADVPEPFKGGAIAMITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosine Hydroxylase (Ab9) Antibody
33120-01 50 µL

Tyrosine Hydroxylase (Ab9) Antibody

Sign In for Pricing
View Details
Tyrosine Hydroxylase (Ab9) Antibody
33120-02 100 µL

Tyrosine Hydroxylase (Ab9) Antibody

Sign In for Pricing
View Details
ACOT11, CT (ACOT11, BFIT, KIAA0707, THEA, Acyl-coenzyme A thioesterase 11, Acyl-CoA thioester hydrolase 11, Adipose-associated thioesterase, Brown fat-inducible thioesterase) (MaxLight 650)
MBS6270977-01 0.1 mL

ACOT11, CT (ACOT11, BFIT, KIAA0707, THEA, Acyl-coenzyme A thioesterase 11, Acyl-CoA thioester hydrolase 11, Adipose-associated thioesterase, Brown fat-inducible thioesterase) (MaxLight 650)

Sign In for Pricing
View Details
ACOT11, CT (ACOT11, BFIT, KIAA0707, THEA, Acyl-coenzyme A thioesterase 11, Acyl-CoA thioester hydrolase 11, Adipose-associated thioesterase, Brown fat-inducible thioesterase) (MaxLight 650)
MBS6270977-02 5x 0.1 mL

ACOT11, CT (ACOT11, BFIT, KIAA0707, THEA, Acyl-coenzyme A thioesterase 11, Acyl-CoA thioester hydrolase 11, Adipose-associated thioesterase, Brown fat-inducible thioesterase) (MaxLight 650)

Sign In for Pricing
View Details
Polyclonal Antibody to Family With Sequence Similarity 19, Member A3 (FAM19A3)
MBS2026209-01 0.1 mL

Polyclonal Antibody to Family With Sequence Similarity 19, Member A3 (FAM19A3)

Sign In for Pricing
View Details
Polyclonal Antibody to Family With Sequence Similarity 19, Member A3 (FAM19A3)
MBS2026209-02 0.2 mL

Polyclonal Antibody to Family With Sequence Similarity 19, Member A3 (FAM19A3)

Sign In for Pricing
View Details