Recombinant Pasteurella multocida Electron transport complex protein RnfA (rnfA)
This Recombinant Pasteurella multocida Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfA
UniProt
Q9CNP0
Expression Region
1-192
Origin
Pasteurella multocida (strain Pm70)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTEYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMSLATMFVLTVASISAYLID TYILTPLSATFLRTLVFILVIAVVVQFTEMVINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINQAHTLTQSVIYGFGASLGFGLVLVLFAALRERLAAADVPHVFKGASIALITAGLM SLAFMGFTGLVR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL314106V 500 µL Each
CD1 (CD1A) Human shRNA Lentiviral Particle (Locus ID 909)
Sign In for Pricing
View Details 
MBS6224808-01 0.1 mL
SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) (MaxLight 650)
Sign In for Pricing
View Details MBS6224808-02 5x 0.1 mL
SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) (MaxLight 650)
Sign In for Pricing
View Details