Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Electron transport complex protein RnfA (rnfA)

This Recombinant Pasteurella multocida Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q9CNP0

Expression Region

1-192

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMSLATMFVLTVASISAYLID TYILTPLSATFLRTLVFILVIAVVVQFTEMVINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINQAHTLTQSVIYGFGASLGFGLVLVLFAALRERLAAADVPHVFKGASIALITAGLM SLAFMGFTGLVR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flufenacet
TRC-F599420-250MG 250 mg

Flufenacet

Sign In for Pricing
View Details
Rad9, phosphorylated (Ser341) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (MaxLight 490) discontinued
R0444-67F-ML490 100 µL

Rad9, phosphorylated (Ser341) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Pt K2
ABL-TC0565 1 Vial

Pt K2

Sign In for Pricing
View Details
Sema4a (NM_001163490) Mouse Tagged Lenti ORF Clone
MR216372L3 10 µg

Sema4a (NM_001163490) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SKA3 sgRNA CRISPR Lentivector set (Human)
K2804401 3x 1.0 µg

SKA3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
HEK293T-LILRB2-new Overexpressing Cell Line
RG-1148 5x 10^6

HEK293T-LILRB2-new Overexpressing Cell Line

Sign In for Pricing
View Details