Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Electron transport complex protein RnfA (rnfA)

This Recombinant Pasteurella multocida Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q9CNP0

Expression Region

1-192

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMSLATMFVLTVASISAYLID TYILTPLSATFLRTLVFILVIAVVVQFTEMVINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINQAHTLTQSVIYGFGASLGFGLVLVLFAALRERLAAADVPHVFKGASIALITAGLM SLAFMGFTGLVR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Tyrosine Phosphatase Type IVA 1 (PTP4A1) Polyclonal Antibody
CAU23232-01 100 µL

Protein Tyrosine Phosphatase Type IVA 1 (PTP4A1) Polyclonal Antibody

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase Type IVA 1 (PTP4A1) Polyclonal Antibody
CAU23232-02 200 µL

Protein Tyrosine Phosphatase Type IVA 1 (PTP4A1) Polyclonal Antibody

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase Type IVA 1 (PTP4A1) Polyclonal Antibody
CAU23232-03 1 mL

Protein Tyrosine Phosphatase Type IVA 1 (PTP4A1) Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal NKp46/NCR1 Antibody (195314R) [PE/Cy5.5]
FAB1850RPECY55 0.1 mL

Mouse Monoclonal NKp46/NCR1 Antibody (195314R) [PE/Cy5.5]

Sign In for Pricing
View Details
Rat Monoclonal CD74 Antibody (829706) [HRP]
FAB7478H 0.1 mL

Rat Monoclonal CD74 Antibody (829706) [HRP]

Sign In for Pricing
View Details
Tert-Butyl chlorosulfonylcarbamate compound with 1,4-diazabicyclo[2.2.2]octane (1:2)
HY-78394 1 Each

Tert-Butyl chlorosulfonylcarbamate compound with 1,4-diazabicyclo[2.2.2]octane (1:2)

Sign In for Pricing
View Details