Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

P71395

Expression Region

1-192

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVD HYILIPLNATFLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVAADIPATFRGSSIALITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SynCam/CADM1 Protein (His Tag)
PKSH031228 100 µg

Recombinant Human SynCam/CADM1 Protein (His Tag)

Sign In for Pricing
View Details
EMP3 (NM_001425) Human Over-expression Lysate
LY400554 100 µg

EMP3 (NM_001425) Human Over-expression Lysate

Sign In for Pricing
View Details
Tau (S293) Antibody
KC-43235-01 50 μL

Tau (S293) Antibody

Sign In for Pricing
View Details
Tau (S293) Antibody
KC-43235-02 100 µL

Tau (S293) Antibody

Sign In for Pricing
View Details
Tau (S293) Antibody
KC-43235-03 1 mL

Tau (S293) Antibody

Sign In for Pricing
View Details
Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit
E-EL-H1495-01 24 Tests

Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details