Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA)

This Recombinant Haemophilus influenzae Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

P71395

Expression Region

1-192

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVD HYILIPLNATFLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVAADIPATFRGSSIALITAGLM SLAFMGFTGLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoethyl Potassium Malonate
TRC-M542530-50G 50 g

Monoethyl Potassium Malonate

Sign In for Pricing
View Details
CCDC69 (NM_015621) Human Recombinant Protein
TP317758 20 µg

CCDC69 (NM_015621) Human Recombinant Protein

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF647 conjugate, 0.1mg/mL
BNC470859-100 1x 100 µL

Human Kappa Light Chain (Kap-56), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UBE2S (NM_014501) Human Over-expression Lysate
LC402342 20 µg

UBE2S (NM_014501) Human Over-expression Lysate

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Coagulation Factor XIII B chain/F13B protein (His tag)
PDMH100391-01 20 µg

Recombinant Human Coagulation Factor XIII B chain/F13B protein (His tag)

Sign In for Pricing
View Details