Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfA (rnfA)

This Recombinant Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

P65543

Expression Region

1-193

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hccs 3'UTR Luciferase Stable Cell Line
TU109389 1.0 mL

Hccs 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
IL21 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV711419 1.0 µg DNA

IL21 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Nociceptin Receptor (OPRL1) Mouse ELISA Kit
F4148 96 Tests

Nociceptin Receptor (OPRL1) Mouse ELISA Kit

Sign In for Pricing
View Details
Zfp329 Mouse shRNA Plasmid (Locus ID 67230)
TL503848 1 Kit

Zfp329 Mouse shRNA Plasmid (Locus ID 67230)

Sign In for Pricing
View Details
Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)
32-11268-10 10 µg

Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)

Sign In for Pricing
View Details
NF-kB (Nuclear Factor kappa B, RelA) (AP) discontinued
N2302-03B-AP 100 µL

NF-kB (Nuclear Factor kappa B, RelA) (AP) discontinued

Sign In for Pricing
View Details