Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Electron transport complex protein RnfA (rnfA)

This Recombinant Salmonella typhimurium Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

P65542

Expression Region

1-193

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD147 (BSG/963), CF640R conjugate, 0.1mg/mL
BNC400963-500 1x 500 µL

CD147 (BSG/963), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(S)-2-(4-Chlorophenyl)-2-hydroxyacetic Acid
TRC-C596875-50MG 50 mg

(S)-2-(4-Chlorophenyl)-2-hydroxyacetic Acid

Sign In for Pricing
View Details
C3 Antibody (HRP)
KH-2252-01 50 μL

C3 Antibody (HRP)

Sign In for Pricing
View Details
C3 Antibody (HRP)
KH-2252-02 100 µL

C3 Antibody (HRP)

Sign In for Pricing
View Details
C3 Antibody (HRP)
KH-2252-03 1 mL

C3 Antibody (HRP)

Sign In for Pricing
View Details
Samd14 Mouse Gene Knockout Kit (CRISPR)
KN515273 1 Kit

Samd14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details