Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Electron transport complex protein RnfA (rnfA)

This Recombinant Salmonella typhimurium Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

P65542

Expression Region

1-193

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF2 (NM_006874) Human Recombinant Protein
TP760288 50 µg

ELF2 (NM_006874) Human Recombinant Protein

Sign In for Pricing
View Details
PRSS41 Human Gene Knockout Kit (CRISPR)
KN425456 1 Kit

PRSS41 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
H-Ala-2-CT Polystyrene Resin
H0370753301.25G 25 g

H-Ala-2-CT Polystyrene Resin

Sign In for Pricing
View Details
BLAP75 (RMI1) Human Gene Knockout Kit (CRISPR)
KN208030RB 1 Kit

BLAP75 (RMI1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Apolipoprotein CIII (APOC3) (NM_000040) Human Recombinant Protein
TP306566 20 µg

Apolipoprotein CIII (APOC3) (NM_000040) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Mrps25 activation kit by CRISPRa
GA206484 1 Kit

Mouse Mrps25 activation kit by CRISPRa

Sign In for Pricing
View Details