Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfA (rnfA)

This Recombinant Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

P0A767

Expression Region

1-193

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Arfgef1 Pre-designed siRNA Set B
SI100843B 1 Each

Mouse Arfgef1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CERKL Polyclonal Antibody
JOT-AP01713-01 20 µL

CERKL Polyclonal Antibody

Sign In for Pricing
View Details
CERKL Polyclonal Antibody
JOT-AP01713-02 50 μL

CERKL Polyclonal Antibody

Sign In for Pricing
View Details
CERKL Polyclonal Antibody
JOT-AP01713-03 100 µL

CERKL Polyclonal Antibody

Sign In for Pricing
View Details
PSMD4 (26S Proteasome Non-ATPase Regulatory Subunit 4, 26S Proteasome Regulatory Subunit S5A, 26S Proteasome Regulatory Subunit RPN10, Multiubiquitin Chain-binding Protein, Antisecretory Factor 1) (MaxLight 650)
MBS6224081-01 0.1 mL

PSMD4 (26S Proteasome Non-ATPase Regulatory Subunit 4, 26S Proteasome Regulatory Subunit S5A, 26S Proteasome Regulatory Subunit RPN10, Multiubiquitin Chain-binding Protein, Antisecretory Factor 1) (MaxLight 650)

Sign In for Pricing
View Details
PSMD4 (26S Proteasome Non-ATPase Regulatory Subunit 4, 26S Proteasome Regulatory Subunit S5A, 26S Proteasome Regulatory Subunit RPN10, Multiubiquitin Chain-binding Protein, Antisecretory Factor 1) (MaxLight 650)
MBS6224081-02 5x 0.1 mL

PSMD4 (26S Proteasome Non-ATPase Regulatory Subunit 4, 26S Proteasome Regulatory Subunit S5A, 26S Proteasome Regulatory Subunit RPN10, Multiubiquitin Chain-binding Protein, Antisecretory Factor 1) (MaxLight 650)

Sign In for Pricing
View Details