Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

P0A766

Expression Region

1-193

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse VNN1/Vanin-1 Protein (His Tag)
PKSM040423 100 µg

Recombinant Mouse VNN1/Vanin-1 Protein (His Tag)

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Recombinant Human Ephrin-A5/EFNA5 protein (His tag)
PDMH100397-01 20 µg

Recombinant Human Ephrin-A5/EFNA5 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Ephrin-A5/EFNA5 protein (His tag)
PDMH100397-02 100 µg

Recombinant Human Ephrin-A5/EFNA5 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Ephrin-A5/EFNA5 protein (His tag)
PDMH100397-03 500 µg

Recombinant Human Ephrin-A5/EFNA5 protein (His tag)

Sign In for Pricing
View Details