Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas hydrophila subsp. hydrophila Electron transport complex protein RnfA (rnfA)

This Recombinant Aeromonas hydrophila subsp. hydrophila Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A0KLJ2

Expression Region

1-193

Origin

Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLVGTVLINNFVLVKFLGLCPFMGVSGKLETAIGMGLATTFVMTLASACSYLME HYILIPLNIAYLRTLAFILVIAVVVQFTEMVIRKSSPTLYRLLGIFLPLITTNCAVLGVA LLSINEHHNFIQSIIYGFGAATGFSLVLILFAAMRERLVAADVPTPFRGVSIAMITAGLM SLAFMGFTGLIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN2 Peptide
DF12103-BP 1 mg

NSUN2 Peptide

Sign In for Pricing
View Details
Human Monoclonal Fluorescein Antibody (4-4-20 (enhanced)) [Alexa Fluor 594]
NBP2-81024AF594 0.1 mL

Human Monoclonal Fluorescein Antibody (4-4-20 (enhanced)) [Alexa Fluor 594]

Sign In for Pricing
View Details
S-Acetyl-PEG-OH, 1K
HE194002-1K Inquire

S-Acetyl-PEG-OH, 1K

Sign In for Pricing
View Details
Mouse Human Rb (Retinoblastoma) Antibody
orb108610 100 µg

Mouse Human Rb (Retinoblastoma) Antibody

Sign In for Pricing
View Details
2-Bromo-1,3-propanediol-d4
004971 2.5 mg

2-Bromo-1,3-propanediol-d4

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii GTPase Der (der)
MBS1061926-01 0.02 mg (E-Coli)

Recombinant Mycobacterium vanbaalenii GTPase Der (der)

Sign In for Pricing
View Details