Recombinant Electron transport complex protein RnfA (rnfA)
This Recombinant Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfA
UniProt
A1ABH2
Expression Region
1-193
Origin
Escherichia coli O1:K1 / APEC
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTMAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6347950-01 0.1 mL
SLAMF7, ID (SLAMF7, CS1, SLAM family member 7, CD2 subset 1, CD2-like receptor-activating cytotoxic cells, Membrane protein FOAP-12, Novel Ly9, Protein 19A, CD319) (MaxLight 405)
Sign In for Pricing
View Details MBS6347950-02 5x 0.1 mL
SLAMF7, ID (SLAMF7, CS1, SLAM family member 7, CD2 subset 1, CD2-like receptor-activating cytotoxic cells, Membrane protein FOAP-12, Novel Ly9, Protein 19A, CD319) (MaxLight 405)
Sign In for Pricing
View Details