Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfA (rnfA)

This Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA, Nitrogen fixation protein RnfA

UniProt

A3PRP3

Expression Region

1-193

Origin

Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDFFFILLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVLTLAAGASWMVE ALILEPLDLTFLRILSLILVIAAIVQFIEVVMRKLAPGLHRALGIYLPLITTNCAVLGVA LLNIQEGHGLASSLLYGFGSASGFTLVLVIFAGMRERLAQLSVPGPFAGAPIAFISAGLL SMAFMGFAGLAPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCOR3 Polyclonal Antibody
E-AB-19039-01 20 µL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
RCOR3 Polyclonal Antibody
E-AB-19039-02 60 µL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
RCOR3 Polyclonal Antibody
E-AB-19039-03 120 µL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
RCOR3 Polyclonal Antibody
E-AB-19039-04 200 µL

RCOR3 Polyclonal Antibody

Sign In for Pricing
View Details
CDX2 (GI Epithelial Marker) (CDX2/2951R), CF568 conjugate, 0.1mg/mL
BNC682951-100 1x 100 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ABCE1 Monoclonal Antibody
E-AB-81521-01 50 µL

Recombinant ABCE1 Monoclonal Antibody

Sign In for Pricing
View Details