Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfA (rnfA)

This Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA, Nitrogen fixation protein RnfA

UniProt

A3PRP3

Expression Region

1-193

Origin

Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDFFFILLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVLTLAAGASWMVE ALILEPLDLTFLRILSLILVIAAIVQFIEVVMRKLAPGLHRALGIYLPLITTNCAVLGVA LLNIQEGHGLASSLLYGFGSASGFTLVLVIFAGMRERLAQLSVPGPFAGAPIAFISAGLL SMAFMGFAGLAPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decanal
TRC-D212505-50G 50 g

Decanal

Sign In for Pricing
View Details
Smarca1 Mouse Gene Knockout Kit (CRISPR)
KN516281 1 Kit

Smarca1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS506289 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
PFKFB3 (NM_004566) Human Over-expression Lysate
LY401447 100 µg

PFKFB3 (NM_004566) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562476 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS502431 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details