Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis Electron transport complex protein RnfA (rnfA)

This Recombinant Yersinia pestis Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A4TJ27

Expression Region

1-193

Origin

Yersinia pestis (strain Pestoides F)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVN SFILLPLGLIYLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAVADVPAPFRRSSIALITAGLM SLAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD3 ORF Vector (Human) (pORF)
ORF013429 1.0 µg DNA

KCTD3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Keratin 12 Rabbit pAb
APA4248-01 30 µL

Keratin 12 Rabbit pAb

Sign In for Pricing
View Details
Keratin 12 Rabbit pAb
APA4248-02 50 μL

Keratin 12 Rabbit pAb

Sign In for Pricing
View Details
Keratin 12 Rabbit pAb
APA4248-03 100 µL

Keratin 12 Rabbit pAb

Sign In for Pricing
View Details
Rabbit Chromogranin A (CHGA) ELISA Kit
MBS2601182-01 48 Well

Rabbit Chromogranin A (CHGA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Chromogranin A (CHGA) ELISA Kit
MBS2601182-02 96 Well

Rabbit Chromogranin A (CHGA) ELISA Kit

Sign In for Pricing
View Details