Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas salmonicida Electron transport complex protein RnfA (rnfA)

This Recombinant Aeromonas salmonicida Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A4SNP5

Expression Region

1-193

Origin

Aeromonas salmonicida (strain A449)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLVSTVLINNFVLVKFLGLCPFMGVSGKLETAVGMGLATTFVMTLASASSYLME HYILIPLNIAYLRTLAFILVIAVVVQFTEMVIRKSSPTLYRLLGIFLPLITTNCAVLGVA LLSINERHNFIQSIIYGFGAAAGFSLVLILFAAMRERLVAADVPTPFRGVSIAMVTAGLM SLAFMGFTGLIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC2 (m) -PR
sc-37501-PR 10 µM - 20 µL

TACC2 (m) -PR

Sign In for Pricing
View Details
RCC1 Polyclonal Antibody
RD83751A-01 60 μL

RCC1 Polyclonal Antibody

Sign In for Pricing
View Details
RCC1 Polyclonal Antibody
RD83751A-02 120 μL

RCC1 Polyclonal Antibody

Sign In for Pricing
View Details
RCC1 Polyclonal Antibody
RD83751A-03 200 µL

RCC1 Polyclonal Antibody

Sign In for Pricing
View Details
PBP2 Adenovirus (Rat)
36075056 1.0 mL

PBP2 Adenovirus (Rat)

Sign In for Pricing
View Details
Peroxin 10 siRNA (h)
sc-88379 10 µM

Peroxin 10 siRNA (h)

Sign In for Pricing
View Details