Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas salmonicida Electron transport complex protein RnfA (rnfA)

This Recombinant Aeromonas salmonicida Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A4SNP5

Expression Region

1-193

Origin

Aeromonas salmonicida (strain A449)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLVSTVLINNFVLVKFLGLCPFMGVSGKLETAVGMGLATTFVMTLASASSYLME HYILIPLNIAYLRTLAFILVIAVVVQFTEMVIRKSSPTLYRLLGIFLPLITTNCAVLGVA LLSINERHNFIQSIIYGFGAAAGFSLVLILFAAMRERLVAADVPTPFRGVSIAMVTAGLM SLAFMGFTGLIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryab (NM_009964) Mouse Tagged ORF Clone Lentiviral Particle
MR201515L1V 200 µL

Cryab (NM_009964) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phenylephrine HCl
C08679-01 50 mg

Phenylephrine HCl

Sign In for Pricing
View Details
Phenylephrine HCl
C08679-02 10 mM / 1 mL

Phenylephrine HCl

Sign In for Pricing
View Details
Phenylephrine HCl
C08679-03 1 g

Phenylephrine HCl

Sign In for Pricing
View Details
6-Methoxycarbonylindole-2-boronic acid pinacol ester
438760-01 25 mg

6-Methoxycarbonylindole-2-boronic acid pinacol ester

Sign In for Pricing
View Details
6-Methoxycarbonylindole-2-boronic acid pinacol ester
438760-02 50 mg

6-Methoxycarbonylindole-2-boronic acid pinacol ester

Sign In for Pricing
View Details