Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serratia proteamaculans Electron transport complex protein RnfA (rnfA)

This Recombinant Serratia proteamaculans Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A8GE02

Expression Region

1-193

Origin

Serratia proteamaculans (strain 568)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLFVGTVLVNNFVLVKFLGLCPFLGVSKKLESAIGMGMATTFVMTLASVSAWVIN TFILVPLDLVYLRTLSFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNVNLGYNFLQSAVYGFSAAAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLM SLAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apg-1 (h) -PR
sc-40650-PR 10 µM - 20 µL

Apg-1 (h) -PR

Sign In for Pricing
View Details
Anti-YWHAE Antibody Picoband® (monoclonal, 3G11G2), PE Conjugate
M01687-2-PE 100 µg/Vial

Anti-YWHAE Antibody Picoband® (monoclonal, 3G11G2), PE Conjugate

Sign In for Pricing
View Details
Phospho-IKB epsilon (Ser22) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-15582R-BF555 100 µL

Phospho-IKB epsilon (Ser22) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
2- ((4- ((4-bromo-2-methyl-5-oxo-1-phenyl (3-pyrazolin-3-yl) ) methoxy) -3-methoxyphenyl) methylene) indane-1,3-dione
YQB57675 250 mg

2- ((4- ((4-bromo-2-methyl-5-oxo-1-phenyl (3-pyrazolin-3-yl) ) methoxy) -3-methoxyphenyl) methylene) indane-1,3-dione

Sign In for Pricing
View Details
CCND1 Antibody
orb2656278-01 20 µg

CCND1 Antibody

Sign In for Pricing
View Details
CCND1 Antibody
orb2656278-02 100 µg

CCND1 Antibody

Sign In for Pricing
View Details