Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erwinia tasmaniensis Electron transport complex protein RnfA (rnfA)

This Recombinant Erwinia tasmaniensis Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B2VEQ1

Expression Region

1-193

Origin

Erwinia tasmaniensis (strain DSM 17950 / Et1/99)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLFIGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVITLASICAWLVN HLILLPLDLVYLRTMAYILVIAVVVQFTEMVVRKTSPDLYRLLGIFLPLITTNCAVLGVP LLSVNLNHTFMQAAIYGFSASIGFSLVMVLFAGVRERLVLADVPAPFKGSSIALVTAGLM ALAFMGFAGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL
BNC682540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS804110 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Mouse Sall3 activation kit by CRISPRa
GA204046 1 Kit

Mouse Sall3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Cyp7b1 activation kit by CRISPRa
GA201004 1 Kit

Mouse Cyp7b1 activation kit by CRISPRa

Sign In for Pricing
View Details
Glyphosate Isopropylamine Salt
TRC-G765004-50MG 50 mg

Glyphosate Isopropylamine Salt

Sign In for Pricing
View Details
Human Claudin 14 (CLDN14) activation kit by CRISPRa
GA108401 1 Kit

Human Claudin 14 (CLDN14) activation kit by CRISPRa

Sign In for Pricing
View Details