Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype IB Electron transport complex protein RnfA (rnfA)

This Recombinant Yersinia pseudotuberculosis serotype IB Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B2K4K2

Expression Region

1-193

Origin

Yersinia pseudotuberculosis serotype IB (strain PB1/+)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVN SFILLPLGLIYLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLM SLAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Allergin 1 (MILR1) (NM_001291317) Human Tagged ORF Clone
RG236962 10 µg

Allergin 1 (MILR1) (NM_001291317) Human Tagged ORF Clone

Sign In for Pricing
View Details
Adamantanine
TRC-A208245-25MG 25 mg

Adamantanine

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS502552 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
SYNPR (NM_144642) Human Recombinant Protein
TP305424 20 µg

SYNPR (NM_144642) Human Recombinant Protein

Sign In for Pricing
View Details
Leupaxin (LPXN) (NM_001143995) Human Over-expression Lysate
LC428455 20 µg

Leupaxin (LPXN) (NM_001143995) Human Over-expression Lysate

Sign In for Pricing
View Details
PKC mu (PRKD1) Rabbit Polyclonal Antibody
AP06567PU-N 100 µg

PKC mu (PRKD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details