Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype IB Electron transport complex protein RnfA (rnfA)

This Recombinant Yersinia pseudotuberculosis serotype IB Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B2K4K2

Expression Region

1-193

Origin

Yersinia pseudotuberculosis serotype IB (strain PB1/+)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVN SFILLPLGLIYLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVA LLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLM SLAFMGFTGLVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF888 activation kit by CRISPRa
GA117969 1 Kit

Human ZNF888 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS803444 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09792P-01 20 Tests

PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09792P-02 100 Tests

PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09792P-03 2x 100 Tests

PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Intedanib
TRC-I666650-50MG 50 mg

Intedanib

Sign In for Pricing
View Details