Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aliivibrio salmonicida Electron transport complex protein RnfA (rnfA)

This Recombinant Aliivibrio salmonicida Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B6EGH7

Expression Region

1-193

Origin

Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSKKLESAIGMGLATTFVLTLASVCSYLIE TYILAPLGIEYLRTMSFILVIAVVVQFTEMVVHKTSPTLYRVLGIFLPLITTNCAVLGVA LLNVTENHNFIESIIYGFGAAVGFSLVLILFSAMRERIAAADVPLPFKGASIAMITAGLM SLAFMGFTGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (diethylphosphonatoamino) -1,1,1,3,3,3-hexafluoro-2- (N1-phenylhydrazine-1-carbothioamido) propane
PC32183 1 Each

2- (diethylphosphonatoamino) -1,1,1,3,3,3-hexafluoro-2- (N1-phenylhydrazine-1-carbothioamido) propane

Sign In for Pricing
View Details
CD46 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1529R-BF750-01 20 µL

CD46 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
CD46 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1529R-BF750-02 100 µL

CD46 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Phospho-PTPN11 (Tyr511) Rabbit Polyclonal Antibody (APC-Cy7)
orb2426319 100 µL

Phospho-PTPN11 (Tyr511) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Anti-SLC35A4 Antibody
CTA4787-01 30 µL

Anti-SLC35A4 Antibody

Sign In for Pricing
View Details
Anti-SLC35A4 Antibody
CTA4787-02 50 μL

Anti-SLC35A4 Antibody

Sign In for Pricing
View Details