Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O157:H7 Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia coli O157:H7 Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B5Z461

Expression Region

1-193

Origin

Escherichia coli O157:H7 (strain EC4115 / EHEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-100 1x 100 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-500 1x 500 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details