Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Electron transport complex protein RnfA (rnfA)

This Recombinant Salmonella paratyphi A Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B5BKB0

Expression Region

1-193

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKRIR (THAP12) Rabbit Polyclonal Antibody
TA365946 100 µL

PRKRIR (THAP12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXCR3 (NM_001504) Human Over-expression Lysate
LC400578 20 µg

CXCR3 (NM_001504) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LSM3 activation kit by CRISPRa
GA109092 1 Kit

Human LSM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Lptn/XCL1 Antibody Pair Set
E-KAB-0714 50 µL & 100 µg

Mouse Lptn/XCL1 Antibody Pair Set

Sign In for Pricing
View Details
Recombinant XRCC1 Antibody
RC-5972-01 50 μL

Recombinant XRCC1 Antibody

Sign In for Pricing
View Details
Recombinant XRCC1 Antibody
RC-5972-02 100 µL

Recombinant XRCC1 Antibody

Sign In for Pricing
View Details