Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B7L5I0

Expression Region

1-193

Origin

Escherichia coli (strain 55989 / EAEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPCR1 Lentiviral Activation Particles (m2)
sc-435298-LAC-2 200 µL

DPCR1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
ATG3 Antibody
GWB-MV478A 50 µg

ATG3 Antibody

Sign In for Pricing
View Details
Recombinant Neurotrophin 3 (NT3)
TRV-0007130-01 10 µg

Recombinant Neurotrophin 3 (NT3)

Sign In for Pricing
View Details
Recombinant Neurotrophin 3 (NT3)
TRV-0007130-02 50 µg

Recombinant Neurotrophin 3 (NT3)

Sign In for Pricing
View Details
Recombinant Neurotrophin 3 (NT3)
TRV-0007130-03 100 µg

Recombinant Neurotrophin 3 (NT3)

Sign In for Pricing
View Details
Recombinant Neurotrophin 3 (NT3)
TRV-0007130-04 200 µg

Recombinant Neurotrophin 3 (NT3)

Sign In for Pricing
View Details