Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia fergusonii Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia fergusonii Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B7LQP3

Expression Region

1-193

Origin

Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVANVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Horse Apolipoprotein A1 Binding Protein (APOA1BP)
RPU54694-01 50 µg

Recombinant Horse Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
Recombinant Horse Apolipoprotein A1 Binding Protein (APOA1BP)
RPU54694-02 100 µg

Recombinant Horse Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
Recombinant Horse Apolipoprotein A1 Binding Protein (APOA1BP)
RPU54694-03 1 mg

Recombinant Horse Apolipoprotein A1 Binding Protein (APOA1BP)

Sign In for Pricing
View Details
Recombinant Merluccius australis australis Nucleoside diphosphate kinase B (nme2)
MBS1199456-01 0.02 mg (E-Coli)

Recombinant Merluccius australis australis Nucleoside diphosphate kinase B (nme2)

Sign In for Pricing
View Details
Recombinant Merluccius australis australis Nucleoside diphosphate kinase B (nme2)
MBS1199456-02 0.1 mg (E-Coli)

Recombinant Merluccius australis australis Nucleoside diphosphate kinase B (nme2)

Sign In for Pricing
View Details
Recombinant Merluccius australis australis Nucleoside diphosphate kinase B (nme2)
MBS1199456-03 0.02 mg (Yeast)

Recombinant Merluccius australis australis Nucleoside diphosphate kinase B (nme2)

Sign In for Pricing
View Details