Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O7:K1 Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia coli O7:K1 Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B7NU06

Expression Region

1-193

Origin

Escherichia coli O7:K1 (strain IAI39 / ExPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K0406, NT (TTI1, KIAA0406, SMG10, TELO2-interacting protein 1 homolog, Protein SMG10) (Azide free) (HRP) discontinued
037238-HRP 200 µL

K0406, NT (TTI1, KIAA0406, SMG10, TELO2-interacting protein 1 homolog, Protein SMG10) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
4- (trans-4-Ethylcyclohexyl) benzonitrile
sc-485554 5 g

4- (trans-4-Ethylcyclohexyl) benzonitrile

Sign In for Pricing
View Details
CD64 (FITC) discontinued
516457-01 20 Tests

CD64 (FITC) discontinued

Sign In for Pricing
View Details
CD64 (FITC) discontinued
516457-02 100 Tests

CD64 (FITC) discontinued

Sign In for Pricing
View Details
Cathelicidin/Camp Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4735R-BF647 100 µL

Cathelicidin/Camp Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
CAPN12 Antibody
orb1557276-01 50 μL

CAPN12 Antibody

Sign In for Pricing
View Details