Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus parasuis serovar 5 Electron transport complex protein RnfA (rnfA)

This Recombinant Haemophilus parasuis serovar 5 Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B8F7B7

Expression Region

1-193

Origin

Haemophilus parasuis serovar 5 (strain SH0165)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVEYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVE TYLLIPLEAEFLRTLVFILVIAVIVQLTEMIVHKTSSALYRLLGIYLPLITTNCAVLGVA LLNVNLSNNLVQSVLYGFGAAAGFSLVLVLFSALRERLVAADVPRAFQGASIALITAGLM SLAFMGFTGLVKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK alpha 2 Rabbit Polyclonal Antibody (Cy7)
orb1084891 100 µL

AMPK alpha 2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Ncam1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6780605 3x 1.0 µg

Ncam1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PNMT Polyclonal Antibody, Cy3 Conjugated
bs-3912R-Cy3 100 µL

PNMT Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Rabbit Vimentin Recombinant Monoclonal Antibody
orb1519747-01 10 µL

Rabbit Vimentin Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Vimentin Recombinant Monoclonal Antibody
orb1519747-02 100 µL

Rabbit Vimentin Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Sheep Interleukin 1alpha, IL-1alpha ELISA Kit
MBS1602079-01 48 Well

Sheep Interleukin 1alpha, IL-1alpha ELISA Kit

Sign In for Pricing
View Details