Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Electron transport complex protein RnfA (rnfA)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B8D8R4

Expression Region

1-193

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHYILFFISNILIENFILVKFLGLCPFLGASSNIETAFGMSCATTFVILTSSVLLWCVN FFILLPLDLIYLRIIAYMLIVSVSVQFLEIVLRKTSPILYRLLGIFLPLITTNCTVLAIP LFSLYEHHTFLESIFYGLSASLGFALVMIIFSCIRERIVLSDIPLPFQGAPIILITVSLI SITFMGFKGLIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPYSL4 Antibody
KC-44613-01 50 μL

DPYSL4 Antibody

Sign In for Pricing
View Details
DPYSL4 Antibody
KC-44613-02 100 µL

DPYSL4 Antibody

Sign In for Pricing
View Details
DPYSL4 Antibody
KC-44613-03 1 mL

DPYSL4 Antibody

Sign In for Pricing
View Details
Human DPP8 activation kit by CRISPRa
GA110335 1 Kit

Human DPP8 activation kit by CRISPRa

Sign In for Pricing
View Details
CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: OTI2B9]
CF805476 100 µg

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: OTI2B9]

Sign In for Pricing
View Details
Mouse Slit Homolog 3 (Slit3) ELISA Kit
RDR-Slit3-Mu-01 96 Tests

Mouse Slit Homolog 3 (Slit3) ELISA Kit

Sign In for Pricing
View Details