Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Electron transport complex protein RnfA (rnfA)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

B8D8R4

Expression Region

1-193

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHYILFFISNILIENFILVKFLGLCPFLGASSNIETAFGMSCATTFVILTSSVLLWCVN FFILLPLDLIYLRIIAYMLIVSVSVQFLEIVLRKTSPILYRLLGIFLPLITTNCTVLAIP LFSLYEHHTFLESIFYGLSASLGFALVMIIFSCIRERIVLSDIPLPFQGAPIILITVSLI SITFMGFKGLIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glibornuride
TRC-G409700-5MG 5 mg

Glibornuride

Sign In for Pricing
View Details
XCL1 Antibody
KC-8295-01 50 μL

XCL1 Antibody

Sign In for Pricing
View Details
XCL1 Antibody
KC-8295-02 100 µL

XCL1 Antibody

Sign In for Pricing
View Details
XCL1 Antibody
KC-8295-03 1 mL

XCL1 Antibody

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF405L conjugate, 0.1mg/mL
BNC060315-100 1x 100 µL

Heparan Sulphate Proteoglycan (A7L6), CF405L conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp397 Mouse Gene Knockout Kit (CRISPR)
KN519820 1 Kit

Zfp397 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details