Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Electron transport complex protein RnfA (rnfA)

This Recombinant Salmonella paratyphi C Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

C0Q506

Expression Region

1-193

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLIYLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pom121l12 siRNA Oligos set (Mouse)
37211174 3x 5 nmol

Pom121l12 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
TIGD3 Polyclonal Antibody
BT-AP09029-01 20 µL

TIGD3 Polyclonal Antibody

Sign In for Pricing
View Details
TIGD3 Polyclonal Antibody
BT-AP09029-02 50 µL

TIGD3 Polyclonal Antibody

Sign In for Pricing
View Details
TIGD3 Polyclonal Antibody
BT-AP09029-03 100 µL

TIGD3 Polyclonal Antibody

Sign In for Pricing
View Details
LIFR ELISA Kit (Human) (OKBB00534)
OKBB00534 96 Well

LIFR ELISA Kit (Human) (OKBB00534)

Sign In for Pricing
View Details
Trimethaphan bromide
orb2664059-01 10 mg

Trimethaphan bromide

Sign In for Pricing
View Details